DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and M7.8

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_502069.1 Gene:M7.8 / 187457 WormBaseID:WBGene00010884 Length:230 Species:Caenorhabditis elegans


Alignment Length:161 Identity:36/161 - (22%)
Similarity:70/161 - (43%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTTIDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLL 67
            |:..|.....::|.|:.:::..::...:...|||.::|.....:..:.::.|.::::..| :|:|
 Worm     6 PSATDKYYFEVLRNEEKSEMLKFLLESFRVDEPLNRASKISCEEIEKCLDGALDRALKTE-SSIL 69

  Fly    68 ALDENDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREV-----NLFE- 126
            |..: |...|||.:|......|.      :|.....||..:  .:|.:.|....|     .|.| 
 Worm    70 ARSQ-DTHEIVGCMLNSVWRRDE------SLCTPGEEDKDF--EFHTIRKEVAMVAEILNELHES 125

  Fly   127 ----RYDIPKALYSHVTSVASWKRGKGLGSR 153
                |.|....|:..::||:...|.:||.|:
 Worm   126 FWSLRPDQDVVLHFEISSVSVNHRRQGLASK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
M7.8NP_502069.1 Acetyltransf_1 82..193 CDD:306954 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.