DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and anat-1

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001076662.1 Gene:anat-1 / 177439 WormBaseID:WBGene00015938 Length:285 Species:Caenorhabditis elegans


Alignment Length:230 Identity:44/230 - (19%)
Similarity:80/230 - (34%) Gaps:55/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLALDENDGGRIVGLV 81
            :::||.:|.:.:.....:.:|      :.:....:.|....|:....|.::.  :....:|.|:.
 Worm    82 DNFAQTEAILASLKIDDDKIC------LKELTVMLRDLVQDSLQCSSTCVIR--DVTTRQIDGIA 138

  Fly    82 LACASYPDNVNAGTL---NLKLENVED---------NAWGRMYHL------------LMKAKREV 122
            |||.:...:.....|   ..:.:.|.|         |....||:|            |:..::| 
 Worm   139 LACKTSIFDKQIDRLCAYEFREQRVRDAVEFLKYVFNKLDVMYYLNEHRLYKPVFVALVCVRKE- 202

  Fly   123 NLFERYDIPKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALG 187
             |:.| .|...|.:||.|.|......||.|..:       ...|..||..:|.:.::|       
 Worm   203 -LWGR-GIGTTLMNHVKSAARTDSSDGLISLCS-------NERGHKLMKTYCPTDFAA------- 251

  Fly   188 MECIYSIDYADYKDDEGRVIFTPAAPHTKLRVMAI 222
                  :.|..:|.:..|.......|.|...|.|:
 Worm   252 ------VRYDAFKGEHLRPPIVMRPPETFHSVYAM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
anat-1NP_001076662.1 NAT_SF <192..221 CDD:173926 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.