DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and R05H10.1

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 / 175144 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans


Alignment Length:232 Identity:43/232 - (18%)
Similarity:80/232 - (34%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLAL------D 70
            |.....|:.::..::...:|..||..::|...:    ||....|.:..    ||.|.|      .
 Worm     8 RTAEKSDFDRILKFLAEHFYHEEPSIRASKIAL----EEWLPIFGEMT----TSSLKLPISTVVT 64

  Fly    71 ENDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYH---------------------L 114
            ..||              :|:.|..||......||..  ||.|                     :
 Worm    65 TEDG--------------ENIVAVLLNSMWSREEDEE--RMKHGNGKGDHDTSGYSEALQRFMTI 113

  Fly   115 LMKAKREVNLFERYDIPKALYSHVTSVAS-WKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFY 178
            :.|...|.......|:...:|..::||.. |:| :|:.:::.:..|...|.:....:::..:||.
 Worm   114 VQKCHDEFWNLAPSDVNLVVYREISSVGKPWQR-QGIATKMLSRNMSAARLHNVDGIVSATSSFA 177

  Fly   179 SARQKGALGMECIYSIDYADYKDDEG-RVIFTPAAPH 214
            :.......|.:|:....|:......| :::.|....|
 Worm   178 NQTLLAKNGFQCLKEFPYSGIVSSNGDKLVETDDGSH 214



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.