DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL6 and CG31248

DIOPT Version :9

Sequence 1:NP_611405.2 Gene:AANATL6 / 37212 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster


Alignment Length:226 Identity:40/226 - (17%)
Similarity:88/226 - (38%) Gaps:44/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NDG-ITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLA--VIRQGLSIV 67
            :|| ..||.:...|.......:...|..:|.:.:..|..:....:..:|.:.|.  ....|:|::
  Fly    13 HDGKFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEINLPENRQARLDLRELCRKTALDGVSLL 77

  Fly    68 ALDDNNGGLLVGIAVAETMDPIEMAKQHKE--------AEEMEPNALGRSRKFIAKVEREANIFE 124
            ..:.:.|.:     |:.:.:.|:.|....|        .||::.....|...|:.:|:...::..
  Fly    78 VKEADTGRV-----VSVSFNKIQYAPPPGEDHFFLKFRNEEVKSPQARRLMDFMIEVDGRIDVCA 137

  Fly   125 RFGVSSYLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSG----------------- 172
            .|.:..:..|:.::..||..:.|:...||:...:|      |..:..|                 
  Fly   138 MFNMVCFCELMFLATLPSHERLGLGRSLSQFTIEL------TKELAEGKGLEDIDDKLRSKRPAA 196

  Fly   173 -TNHYSSRSAMKAG----CECIHSVAYADYK 198
             |..::||.:.|.|    .:.|::|:|::::
  Fly   197 VTALWTSRFSQKVGKATDFKVINTVSYSEFE 227



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.