DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL6 and AANATL4

DIOPT Version :9

Sequence 1:NP_611405.2 Gene:AANATL6 / 37212 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster


Alignment Length:218 Identity:86/218 - (39%)
Similarity:130/218 - (59%) Gaps:2/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDD 71
            ||:|:|:|:.:||.:||.:|...::..||:.....||:|.|:||..|....::|.:|.|::|||:
  Fly     7 DGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLALDE 71

  Fly    72 NNGGLLVG--IAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSSYLSL 134
            |:||.:||  :|.|...|.:.....:.:.|.:|.||.||....:.|.:||.|:|||:.:...|..
  Fly    72 NDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERYDIPKALYS 136

  Fly   135 LVISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYADYKD 199
            .|.||....|.:|:...|:..|.:|||..|..|.:...|:.||:|.....|.|||:|:.||||||
  Fly   137 HVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYSIDYADYKD 201

  Fly   200 ELGRPIYNPPAPHTHIRVLASKM 222
            :.||.|:.|.||||.:||:|.|:
  Fly   202 DEGRVIFTPAAPHTKLRVMAIKL 224



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435009
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100876at33392
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 1 1.000 - - mtm9663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.