DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL6 and AANATL5

DIOPT Version :9

Sequence 1:NP_611405.2 Gene:AANATL6 / 37212 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_611403.1 Gene:AANATL5 / 37210 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster


Alignment Length:222 Identity:217/222 - (97%)
Similarity:218/222 - (98%) Gaps:0/222 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILSQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLS 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MILSQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLS 65

  Fly    66 IVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSS 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 IVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSS 130

  Fly   131 YLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYA 195
            ||||||||||||||||||||||||||||||||||..|||.|||||||||||||||||||||||||
  Fly   131 YLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVAYA 195

  Fly   196 DYKDELGRPIYNPPAPHTHIRVLASKM 222
            |||||.||||||||||||||||||||:
  Fly   196 DYKDEQGRPIYNPPAPHTHIRVLASKL 222



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435008
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100876at33392
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.