DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL6 and AANATL3

DIOPT Version :9

Sequence 1:NP_611405.2 Gene:AANATL6 / 37212 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_610018.1 Gene:AANATL3 / 35285 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster


Alignment Length:222 Identity:92/222 - (41%)
Similarity:134/222 - (60%) Gaps:0/222 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILSQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLS 65
            |..|..||||:|.|.::|||.||.|:.|.|...||:.....|.:..|:|:|.|..:|::|.||..
  Fly     1 MASSIKDGITIRTMTKEDYPSVKAFLKDNFFQSEPLCQSTSENVQSQNEKENDEYHLSMIAQGTC 65

  Fly    66 IVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSS 130
            :||:|::|||..||:.:|....|.::.|...|||.||.:...|:...::|:|||||:|||||:|.
  Fly    66 LVAIDESNGGKFVGLVLAGAQYPEDLEKHRIEAESMEQHFWARACIMLSKIEREANLFERFGISK 130

  Fly   131 YLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYA 195
            .|...:.||..|||.:|:...|:..|..:||.:|........|:.||:|.....|.:|:||:.||
  Fly   131 LLYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALGMKCVHSLPYA 195

  Fly   196 DYKDELGRPIYNPPAPHTHIRVLASKM 222
            ||||:.||||:.|..|||..|::..|:
  Fly   196 DYKDDQGRPIFTPAEPHTMARIMFIKL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL6NP_611405.2 None
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 1 1.000 - - mtm9663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.