DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL6 and W02D7.4

DIOPT Version :9

Sequence 1:NP_611405.2 Gene:AANATL6 / 37212 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_505142.1 Gene:W02D7.4 / 189116 WormBaseID:WBGene00020940 Length:232 Species:Caenorhabditis elegans


Alignment Length:222 Identity:50/222 - (22%)
Similarity:94/222 - (42%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILS---QNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLE-EPIHLQHEEEVDR-QYLAVI 60
            |:||   :|..:..||.:..|:.|:..|:..:|..:||....|: .|       |:.| .:.|.:
 Worm     1 MMLSKVLRNSPLLFRVAQPKDHERIIKFLDKHFAKEEPCSRALKISP-------EISRGVFTATV 58

  Fly    61 RQGL----SIVALDDNNGGLLVGI--AVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVERE 119
            .:.|    |.|.|.: ||.|...:  :|....||:|.|       :.:...|..:.|...:...:
 Worm    59 TRCLTTPFSTVVLQE-NGDLAACLLASVWNRTDPLENA-------DFDDTGLPENFKLFIQFLNK 115

  Fly   120 ANI-FERF---GVSSYLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGHTL-FITSGTNHYSSR 179
            |:: |.:.   .|:|.:...:.||.|...:.||...:.........|:.:.: .:.|.|...:::
 Worm   116 AHLNFWKIAPPNVNSIIHREIGSVAPQFTRLGIATKMVTTNMTKRNLKKYNIGGVLSETTSLANQ 180

  Fly   180 SAM-KAGCECIHSVAYADYKDELGRPI 205
            ..: |||.:|:..:.|:...|..|..:
 Worm   181 IVLEKAGFKCLKELPYSTIVDSKGNQV 207



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.