DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL6 and R13D11.4

DIOPT Version :9

Sequence 1:NP_611405.2 Gene:AANATL6 / 37212 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_503329.2 Gene:R13D11.4 / 187863 WormBaseID:WBGene00020058 Length:227 Species:Caenorhabditis elegans


Alignment Length:234 Identity:55/234 - (23%)
Similarity:83/234 - (35%) Gaps:66/234 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MKEDDYPRVK----------TFMTDYFHYDEPM----GMGLEE---------------PIHLQHE 49
            |.||:|..|:          .|:..:|..:|||    ||..|.               |......
 Worm     1 MSEDNYEFVQLTNENSSELSEFLMSHFLLEEPMNRAIGMSRENFQPFVDKLFERTLNIPFSFALV 65

  Fly    50 EEVDRQYLAVIRQGLSIVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEM-EPNALGR-SRKF 112
            |:..|::.|.....|.|...:|          ||           ||:.|.. :....|. .||.
 Worm    66 EKDSRKFAACAMSSLWINEKND----------VA-----------HKDTENHGDEFTFGNPERKD 109

  Fly   113 IAKV-----EREANIFE-RFGVSSYLSLLVISVHPSMRQRGILVILSKCLFKL---GRLRGHTLF 168
            ||.|     |.....|| ...|...|.|.::||....::||   :.|:.:.|:   .::|.....
 Worm   110 IAAVGKILTELHGKFFEICLDVEQALHLEILSVAKEHQRRG---LASRLMAKMEDPAKMREFKCS 171

  Fly   169 -ITSGTNHYSSRSAM-KAGCECIHSVAYADYKDELGRPI 205
             |.|..:..:::..| |.|...:....:|...||.|||:
 Worm   172 KIASEISSLANQCLMKKRGYTALTETLFASECDESGRPL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL6NP_611405.2 None
R13D11.4NP_503329.2 Acetyltransf_1 <130..191 CDD:366181 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.