DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL6 and M7.12

DIOPT Version :9

Sequence 1:NP_611405.2 Gene:AANATL6 / 37212 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_502070.2 Gene:M7.12 / 187458 WormBaseID:WBGene00010887 Length:241 Species:Caenorhabditis elegans


Alignment Length:143 Identity:31/143 - (21%)
Similarity:60/143 - (41%) Gaps:15/143 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MKEDDYPRVKTFMTDYFHYDEPM--GMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDNNGGL 76
            :|.|:...|..|:.:.|..:||:  ..|:.|.   ..:...|..:..|::..:||:|....:.. 
 Worm    29 VKHDNRNEVVDFLNNNFRVEEPLSKAAGMTES---DIQSCFDGVFERVLKNEVSILARSKQSDE- 89

  Fly    77 LVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREAN-IFERF-----GVSSYLSLL 135
            :||..:.......:..|...|||:.|   .|..||.:..:....| :.|.|     ...:.|...
 Worm    90 IVGCMLNSVWKRNDPKKNEDEAEDFE---FGGDRKGVMTIGEILNELHESFWKLRPDQHTVLHFE 151

  Fly   136 VISVHPSMRQRGI 148
            :.||:.:.:::|:
 Worm   152 ISSVNKNHQRQGL 164



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.