DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and zgc:153169

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001070234.2 Gene:zgc:153169 / 767799 ZFINID:ZDB-GENE-060929-764 Length:289 Species:Danio rerio


Alignment Length:293 Identity:101/293 - (34%)
Similarity:145/293 - (49%) Gaps:45/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 INTWPFAEAKKEAWRLLNVKKGGLGQTRSAVVGGISMCEKLQCAKT----VGYGGNPDERGDTSL 63
            :.||.|:....:..|.|.:    .||..:.|| ..:|.|......|    ||.||.|:..|....
Zfish     4 VGTWSFSRPAVDRMRSLLL----AGQNATDVV-ETAMAEVEDDLDTGRHIVGRGGFPNATGVVEC 63

  Fly    64 DALLMDGGTMEVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMGLQYESLNSEDNI 128
            ||.:|:|.....|||..||.|....:||:.|:|.:.|:||||:||:.||..:|     ..||.|.
Zfish    64 DAAIMEGLPRRFGAVAALRGIPQPCRVARKVMEESPHSLLVGEGAEAFAQDLG-----FTSEPNE 123

  Fly   129 ESLKNWTRHNCQPNFWRNVHPDPRTSCGPYQPLVTWDPNAKQSDRIEIGPDNHDTITMAAIDEEG 193
            :.|.:.|                   ...||..:      ::.:.::.|   ||||.:.|:|..|
Zfish   124 KMLSDHT-------------------ASAYQEFL------EKKEPVKGG---HDTIGLIALDLSG 160

  Fly   194 HIHVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMRAGKT 258
            :|.||.||:|..:.|||||||:.:||...|||:.||||..|||||.:|.:.||...|:.|:.|.:
Zfish   161 NITVGVSTSGAPFKLPGRVGDSPLPGCGLYADHTVGAAAATGDGDKIMCYCPSFHVVQLMKQGSS 225

  Fly   259 PAEAVELVIQRIQKHV---KYFEVAVIVANRLG 288
            |.||...|:..||:.:   :.||:.:|..|..|
Zfish   226 PNEACSAVLADIQRRMGGNQCFEIGLISLNLKG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 101/293 (34%)
zgc:153169NP_001070234.2 Glycosylasparaginase 4..274 CDD:271335 101/293 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.