DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and Asrgl1

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_079886.2 Gene:Asrgl1 / 66514 MGIID:1913764 Length:326 Species:Mus musculus


Alignment Length:308 Identity:90/308 - (29%)
Similarity:143/308 - (46%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AEAKKEAWRLLNVKKGGLGQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDALLMDGGTM 73
            |.|..|.:::|   |.| |....||.|.:::.|. ......|||...:..||..:||.:|||..:
Mouse    45 ARAATEGYKIL---KAG-GSAVDAVEGAVTVLEN-DPEFNAGYGSVLNVNGDIEMDASIMDGKDL 104

  Fly    74 EVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMGLQYESLNSEDNIESLKNWTRHN 138
            ..|||..:|.|.:.:|:|:.|:|.|.|..|.|.||::||..||:                     
Mouse   105 SAGAVSAVRCIANPVKLARLVMEKTPHCFLTGHGAEKFAEDMGI--------------------- 148

  Fly   139 CQPNFWRNVHPDPRTSCGPYQPLVTWDPNAK--QSDRIEIG------PDNHDTITMAAIDEEGHI 195
                        |:.   |.:.|:| :...|  :.:::|.|      |.|..|:...|:|..|::
Mouse   149 ------------PQV---PVEKLIT-ERTKKHLEKEKLEKGAQNADCPKNSGTVGAVALDCRGNL 197

  Fly   196 HVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMRAGKTPA 260
            ...|||.|:...:.|||||:...|:..||||.:||..|||.|:.:::...:.||:..:..|||..
Mouse   198 AYATSTGGIVNKMVGRVGDSPCIGAGGYADNNLGAVSTTGHGESILKVNLARLALFHVEQGKTVE 262

  Fly   261 EAVELVIQRIQKHVKYFEVAVIVANRLGTYAVRCHGTGM---ARDNGK 305
            ||.:|.:..::..:|... .:|:.|:.|.:..:.....|   |..|||
Mouse   263 EAAQLALDYMKSKLKGLG-GLILVNKTGDWVAKWTSASMPWAAVKNGK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 90/308 (29%)
Asrgl1NP_079886.2 ASRGL1_like 19..308 CDD:271338 87/305 (29%)
PRK10226 21..300 CDD:182319 85/297 (29%)
Substrate binding. /evidence=ECO:0000250 213..216 2/2 (100%)
Substrate binding. /evidence=ECO:0000250 236..239 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.