DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and si:dkey-103j14.5

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_005156981.3 Gene:si:dkey-103j14.5 / 570552 ZFINID:ZDB-GENE-090313-170 Length:361 Species:Danio rerio


Alignment Length:290 Identity:76/290 - (26%)
Similarity:124/290 - (42%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GYGGNPDERGDTSLDALLMDGGTMEVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANA 114
            |:|...:..|:..||:::|||.|:..|||..:|.|.:.:.:|:.|:|.|.|.:|...||..||..
Zfish   117 GHGSVLNISGEVELDSIIMDGETLAAGAVASVRNIANPVSLARAVMEKTDHVMLTDRGASMFAEH 181

  Fly   115 MGLQYESLNSEDNIESL--KNWTRHNCQPNFWRNVHPDPRTSCGPYQPLVTWDPNAKQSDRIEIG 177
            :|...    :.|.:..|  |.|......|:                        ..|:....:.|
Zfish   182 IGTPV----AHDLVTELERKEWEHSKSYPD------------------------GVKKFFNTQWG 218

  Fly   178 PDNHDTITMAAIDEEGHIHVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMR 242
               |||:...|:|..|::...|||.|:|..:.|||||:.|.||..||||..||...||.|:.:::
Zfish   219 ---HDTVGAVALDSSGNVACATSTGGIRNKMVGRVGDSPIIGSGGYADNRSGAVSCTGHGESILK 280

  Fly   243 FLPSLLAVEAMRAGKTPAEAVELVIQRIQKHVKYFEVAVIVANRLGTYAVRCHGTGMARDNGKFA 307
            ...:.|.:..:..||:...|.|..:|.:.:.||                 .|.|..:....|.:.
Zfish   281 VTLARLILFHVEQGKSAVGAAEASLQYMSQRVK-----------------GCGGAVLLSSTGDWT 328

  Fly   308 YMVSSPGQ---PVRTESVECSANPEKSPSE 334
            ...::|..   .|:.:.:....||::..:|
Zfish   329 ASFTTPRMAWASVKEDILHYGLNPKEHFTE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 71/263 (27%)
si:dkey-103j14.5XP_005156981.3 ASRGL1_like 56..344 CDD:271338 73/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.