DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and Tasp1

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster


Alignment Length:281 Identity:68/281 - (24%)
Similarity:107/281 - (38%) Gaps:91/281 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VKKGGLGQTRSAVVGG--ISMCE----KLQ-CAKT-VGYGGNPDERGDTSLDALLMDGGTMEVGA 77
            :|:..|..|.....||  :..||    :|: |..| .|||.|....|....||.:|||.|:..||
  Fly    24 IKEACLRATEILRNGGSAVDACEAAIVRLENCGYTNAGYGSNLCMDGSVQCDAAIMDGSTLNFGA 88

  Fly    78 VGDLRRIRSAIKVAQHV---------LEHTLHTLLVGDGADEFANAMGLQYESLNSEDNIESLKN 133
            ..::.|:::.|::|:.:         ||.....:|.|.||:.:|:.:|                 
  Fly    89 CTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGTGAEHYADEVG----------------- 136

  Fly   134 WTRHNCQPNFWRNVHPDPRTSCGPYQPLVTWDPNAK----------------------QSDRIEI 176
                                 |...:|.|.....||                      ..:.:::
  Fly   137 ---------------------CSMVEPGVLISSKAKFQFNHYKSKYDLVVNSRLGKATSEESVQV 180

  Fly   177 -GPDNH-------DTITMAAIDEEGHIHVGTSTNGLRYTLPGRVGDASIPGSAAYA---DNEVGA 230
             .|.|.       ||:....:|..|:...|.|:.|:...:|||||.|:..|:..:|   |....|
  Fly   181 PEPGNEVELAAALDTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIA 245

  Fly   231 AVTTGDGDILMRFLPSLLAVE 251
            ..|||:|:.||:   :|||.|
  Fly   246 TCTTGNGEYLMK---TLLARE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 68/281 (24%)
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 68/281 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439405
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.