DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and CG7860

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285275.1 Gene:CG7860 / 32488 FlyBaseID:FBgn0030653 Length:332 Species:Drosophila melanogaster


Alignment Length:322 Identity:100/322 - (31%)
Similarity:141/322 - (43%) Gaps:35/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EAKKEAWRLLNVKKG-GLGQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDALLMDGGTM 73
            :|.:.||.||:...| |.|....||...:...| |......|||...:..|...|:|.||:|..:
  Fly    29 QALRSAWGLLSPDNGSGGGSALDAVEAAVRSME-LDENFNAGYGSCLNTSGQVELEASLMEGRDL 92

  Fly    74 EVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMG---LQYESLNSEDNIESLKNWT 135
            ..|.:..||.:...|.||:.::|...||.|.|..|.|.|.|.|   ||..:|.:|....:||.:.
  Fly    93 RAGCITLLRDVMHPITVARRLMEKQRHTFLGGAAAQELALATGSERLQPGALVTEGARLTLKEFE 157

  Fly   136 RHNCQPNFWRNVHPDP---RTSCGPYQPLVTWDPNAKQSDRIEIGPDNHDTITMAAIDEEGHIHV 197
            ....|..       ||   ||.....:|:...||:.             :|:...|:|..|.|.|
  Fly   158 DQVAQGK-------DPFFARTELTDDKPVPKTDPSG-------------ETVGAVAMDASGQIVV 202

  Fly   198 GTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMR-AGKTPAE 261
            ||||.|:....|||:||..|.||..||||..|...|||.|:.|||:..:...:.||. .|.:...
  Fly   203 GTSTGGITGKWPGRIGDTPILGSGTYADNCRGGVSTTGHGETLMRYNLAQRILSAMEYQGLSAQA 267

  Fly   262 AVELVIQRIQKHVKYFEVAVIVANR--LG-TYAVRCHGTGMARDNGKFAYMVSSPGQPVRTE 320
            |.:...:.:.|.:.....|::|.:.  || ::..|....|..:| |...|.:.  ||.|..|
  Fly   268 AADKECREMTKRLGGTGGAIVVGHSGDLGISFTSRRMAWGYVQD-GTIFYGIE--GQVVHQE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 96/312 (31%)
CG7860NP_001285275.1 PRK10226 1..311 CDD:182319 93/302 (31%)
ASRGL1_like 3..312 CDD:271338 94/304 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.