DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and Tasp1

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_017447248.1 Gene:Tasp1 / 311468 RGDID:1308591 Length:438 Species:Rattus norvegicus


Alignment Length:327 Identity:79/327 - (24%)
Similarity:123/327 - (37%) Gaps:93/327 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GYGGNPDERGDTSLDALLMDGGTMEVGAVGDLRRIRSAIKVAQHVL----EHTLHT------LLV 104
            |.|.|.:..|:...||.:|||.::..||||.|..|::.:.||..:|    :..|..      .||
  Rat   120 GVGSNLNLLGEIECDASIMDGKSLSFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLV 184

  Fly   105 GDGADEFANAMGLQYESLNSEDNIESLKNWTRHNCQPNFWRNVHPD------PRTSCGPYQPLVT 163
            |:||..:|...|:.....::.....||..:.|:..:......|..|      .|.|         
  Rat   185 GEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKLELAERVETDFIQLKRRRQS--------- 240

  Fly   164 WDPNAKQSDRIEIGPDNHDTITMAAIDEEGHIHVGTSTNGLRYTLPGRVGDASIPGSAAYADNEV 228
               :||::|...:     ||:....:|.||::....|:.||....|||||.|::.|...:|:|..
  Rat   241 ---SAKENDSGAL-----DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTG 297

  Fly   229 G------AAVTTGDGDILMRFLPSLLAVEAMRAGKTPAEAVELVIQRIQKHVKYFEVAVIVANRL 287
            .      |..|:|.|:.|:|   ::||.|...|           :|....|....|..       
  Rat   298 AHNPYSTAVSTSGCGEHLVR---TILARECSHA-----------LQAEDAHQALLETM------- 341

  Fly   288 GTYAVRCHGTGMARDNGKFAYMVSSP---------GQPVRTESVECSANPEKSPSEDDR----QV 339
                           ..||   :|||         |..:...|..|.:  |..||:|.:    :.
  Rat   342 ---------------QNKF---ISSPFLASEDGVLGGVIVLRSCRCPS--ESDPSQDKQTLLVEF 386

  Fly   340 IW 341
            :|
  Rat   387 LW 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 68/283 (24%)
Tasp1XP_017447248.1 Taspase1_like 42..434 CDD:271336 79/327 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.