DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and Asrgl1

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_659557.1 Gene:Asrgl1 / 246307 RGDID:708526 Length:333 Species:Rattus norvegicus


Alignment Length:308 Identity:92/308 - (29%)
Similarity:144/308 - (46%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AEAKKEAWRLLNVKKGGLGQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDALLMDGGTM 73
            |:|..|.:   |:.|.| |....||.|.::|.|. ......|||...:..||..:||.:|||..:
  Rat    51 AKAATEGY---NILKAG-GSAVDAVEGAVTMLEN-DPEFNAGYGSVLNADGDIEMDASIMDGKDL 110

  Fly    74 EVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMGLQYESLNSEDNIESLKNWTRHN 138
            ..|||..:|.|.:.:|:|:.|:|.|.|..|.|.||::||..||:                     
  Rat   111 SAGAVSAVRCIANPVKLARLVMEKTPHCFLTGRGAEKFAADMGI--------------------- 154

  Fly   139 CQPNFWRNVHPDPRTSCGPYQPLVTWDPNAK--QSDRIEIG------PDNHDTITMAAIDEEGHI 195
                        |:|   |.:.|:| :...|  :.:::|.|      |.|..|:...|:|.:|::
  Rat   155 ------------PQT---PAEKLIT-ERTKKHLEKEKLEKGAQKADCPKNSGTVGAVALDCKGNL 203

  Fly   196 HVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMRAGKTPA 260
            ...|||.|:...:.|||||:...|:..||||.:||..|||.|:.:::...:.||:..:..|||..
  Rat   204 AYATSTGGIVNKMVGRVGDSPCIGAGGYADNNLGAVSTTGHGESILKVNLARLALFHVEQGKTVD 268

  Fly   261 EAVELVIQRIQKHVKYFEVAVIVANRLGTYAVRCHGTGM---ARDNGK 305
            ||..|.:..::..:|... .:|:.|:.|.:..:.....|   |..|||
  Rat   269 EAATLALDYMKSKLKGLG-GLILINKTGDWVAKWTSASMPWAAVKNGK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 92/308 (30%)
Asrgl1NP_659557.1 ASRGL1_like 25..314 CDD:271338 89/305 (29%)
PRK10226 27..306 CDD:182319 87/297 (29%)
Substrate binding. /evidence=ECO:0000250 219..222 2/2 (100%)
Substrate binding. /evidence=ECO:0000250 242..245 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.