DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and AGA

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_000018.2 Gene:AGA / 175 HGNCID:318 Length:346 Species:Homo sapiens


Alignment Length:331 Identity:167/331 - (50%)
Similarity:212/331 - (64%) Gaps:21/331 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVINTWPFAEAKKEAWRLLNVKKGGLGQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDA 65
            :|:|||||..|.:.|||.|    ...|....||..|.:|||:.||..:||:||:|||.|:|:|||
Human    29 LVVNTWPFKNATEAAWRAL----ASGGSALDAVESGCAMCEREQCDGSVGFGGSPDELGETTLDA 89

  Fly    66 LLMDGGTMEVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMGLQYESLNSEDNIES 130
            ::|||.||:||||||||||::||.||:.|||||.||||||:.|..||.:||...|.|::..:...
Human    90 MIMDGTTMDVGAVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFAQSMGFINEDLSTTASQAL 154

  Fly   131 LKNWTRHNCQPNFWRNVHPDPRTSCGPYQP--LVTWD-PNAKQS--DRIEIGPDNHDTITMAAID 190
            ..:|...|||||:||||.|||...||||:|  ::..| |..|::  ||      .||||.|..|.
Human   155 HSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGILKQDIPIHKETEDDR------GHDTIGMVVIH 213

  Fly   191 EEGHIHVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMRA 255
            :.|||..||||||:::.:.|||||:.|||:.||||:..|||..||:||||||||||..|||.||.
Human   214 KTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRR 278

  Fly   256 GKTPAEAVELVIQRIQKHVKYFEVAVIVANRLGTYAVRCHGTGMARDNGKFAYMV--SSPGQPVR 318
            |:.|..|.:.||.|||||...|..|||.||..|:|...|:......   :|::||  |...||..
Human   279 GEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFT---QFSFMVYNSEKNQPTE 340

  Fly   319 TESVEC 324
             |.|:|
Human   341 -EKVDC 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 161/317 (51%)
AGANP_000018.2 Glycosylasparaginase 29..332 CDD:271335 161/315 (51%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 234..237 2/2 (100%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 257..260 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141712
Domainoid 1 1.000 318 1.000 Domainoid score I1254
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13
Inparanoid 1 1.050 340 1.000 Inparanoid score I2371
Isobase 1 0.950 - 0 Normalized mean entropy S3395
OMA 1 1.010 - - QHG58368
OrthoDB 1 1.010 - - D1487354at2759
OrthoFinder 1 1.000 - - FOG0004212
OrthoInspector 1 1.000 - - otm40941
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3475
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.