DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and aga

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002934303.3 Gene:aga / 100485379 XenbaseID:XB-GENE-1001622 Length:347 Species:Xenopus tropicalis


Alignment Length:296 Identity:153/296 - (51%)
Similarity:191/296 - (64%) Gaps:6/296 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVINTWPFAEAKKEAWRLLNVKKGGLGQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDA 65
            :|||||||..|.:.|||:|...    |....||..|.:.||..||..:|||||:|||.|:|:|||
 Frog    29 LVINTWPFRNATEAAWRVLEAG----GSVLDAVEKGCAQCEIDQCDGSVGYGGSPDENGETTLDA 89

  Fly    66 LLMDGGTMEVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMGLQYESLNSEDNIES 130
            ::|:|.|||:|||..||||::||.||:.|:|||.||.|||:.|..||.:||...|.|.:..:...
 Frog    90 MIMNGNTMEIGAVAQLRRIKNAIGVARAVMEHTKHTFLVGESASLFAESMGFMREDLTTNHSRSI 154

  Fly   131 LKNWTRHNCQPNFWRNVHPDPRTSCGPYQPLVTWDPNAKQSD-RIEIGPDNHDTITMAAIDEEGH 194
            ...|...:||||:|:||.||...|||||.|. ....|.|||. :.:|...|||||.|.|||:.|:
 Frog   155 HSKWLDQSCQPNYWKNVVPDASKSCGPYHPF-KGVKNEKQSPLQQKINVHNHDTIGMIAIDKAGN 218

  Fly   195 IHVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMRAGKTP 259
            :.|||||||..:.:||||||:.|||:.||||:.||.|..||||||:||||||..|||.||.|..|
 Frog   219 VAVGTSTNGATHKIPGRVGDSPIPGAGAYADSVVGGAAATGDGDIMMRFLPSYQAVEYMRMGSDP 283

  Fly   260 AEAVELVIQRIQKHVKYFEVAVIVANRLGTYAVRCH 295
            ..|.:..|.||||:...|..|||.||..|:|...|:
 Frog   284 TAACQKAIGRIQKYFPNFFGAVICANSTGSYGAACN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 153/296 (52%)
agaXP_002934303.3 Glycosylasparaginase 29..331 CDD:271335 153/296 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 325 1.000 Domainoid score I1194
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13
Inparanoid 1 1.050 344 1.000 Inparanoid score I2271
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487354at2759
OrthoFinder 1 1.000 - - FOG0004212
OrthoInspector 1 1.000 - - otm48136
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3475
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.