DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10474 and asrgl1

DIOPT Version :9

Sequence 1:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_012818179.2 Gene:asrgl1 / 100145284 XenbaseID:XB-GENE-989502 Length:348 Species:Xenopus tropicalis


Alignment Length:300 Identity:93/300 - (31%)
Similarity:139/300 - (46%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EAWRLLNVKKGGL---------GQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDALLMD 69
            |.:| |.||:..|         |...:||...:.:.|. :.....|:|...:|:|...:||::||
 Frog    59 ETYR-LGVKRAVLKGYDVLRQGGSALTAVEEAVIVMED-EPIFNAGHGSVLNEKGYIEMDAIIMD 121

  Fly    70 GGTMEVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMGLQYESLNSEDNIESLKNW 134
            |..::.|||..:|.|.:.||:|:.|:|.|.|.||..:||..||.|.|:                 
 Frog   122 GKNLDSGAVSAVRNIANPIKLARLVMEKTDHMLLTCEGATLFAKAQGI----------------- 169

  Fly   135 TRHNCQPNFWRNVHPDPRTSCGPYQPLVT------WDPNAKQ-----SDRIEIGPDNHDTITMAA 188
                            |.|   |...|:|      |..|.|:     :|:|.:|     |:...|
 Frog   170 ----------------PET---PNDTLITERSRKRWMKNLKENSNPIADQIGLG-----TVGAVA 210

  Fly   189 IDEEGHIHVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAM 253
            ||.||::...|||.||...:.|||||.:..||..||||.|||..|||.|:.:|:.:.:.|.:..|
 Frog   211 IDCEGNMACATSTGGLTNKMVGRVGDTACIGSGGYADNNVGAVSTTGHGESIMKVILARLILHYM 275

  Fly   254 RAGKTPAEAVELVIQRIQKHVKYFEVAVIVANRLGTYAVR 293
            ..||:|.||.:..:..::..|:....|:|| |..|.:..:
 Frog   276 EQGKSPEEAADAGLNYMKSRVEGTGGAIIV-NSSGDWTAK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 93/299 (31%)
asrgl1XP_012818179.2 ASRGL1_like 41..328 CDD:271338 93/299 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.