DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL5 and CG17375

DIOPT Version :9

Sequence 1:NP_611403.1 Gene:AANATL5 / 37210 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_609076.3 Gene:CG17375 / 33956 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster


Alignment Length:95 Identity:23/95 - (24%)
Similarity:36/95 - (37%) Gaps:19/95 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FMTDYFHYDEPMGMGL----EEPIHLQHEEEVDRQYLAVIRQG----LSIVALDDNNGGLLVGIA 81
            |:..:.|......:.|    :|...|...||:.|...::.:.|    ..|:...|....||..:|
  Fly   167 FVAQHMHMPRVSFIALSSVDQEAASLIDYEEIGRTIYSIYKVGNTRPFDILRELDEMYALLFELA 231

  Fly    82 VAETMDPIEM-----------AKQHKEAEE 100
            |:..:..|||           |:..|||.|
  Fly   232 VSPVLKYIEMPGFEEFHEALDARLAKEAAE 261



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.