DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL5 and AANATL2

DIOPT Version :9

Sequence 1:NP_611403.1 Gene:AANATL5 / 37210 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster


Alignment Length:216 Identity:73/216 - (33%)
Similarity:117/216 - (54%) Gaps:5/216 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ITVRVMKEDDYPRVKTFMTDYFHYDEP-MGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDN 72
            ||:|.|...||..|:.|:..:|...|| |.:..|:|...:........:.::|.|.||:||:|  
  Fly     4 ITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVD-- 66

  Fly    73 NGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNA-LGRSRKFIAKVEREANIFERFGVSSYLSLLV 136
             |..:||:.:|..:.|.::.::::|||:.|... |.:..||:|.:||:||||:.:||...|.|.:
  Fly    67 -GERIVGVVLAGELVPEDLEREYQEAEQKEITCLLDKIHKFLAGIERQANIFKHYGVERALYLYM 130

  Fly   137 ISVHPSMRQRGILVILSKCLFKLGRLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVAYADYKDEQ 201
            :.|..|:|::.:...|.:...:|||.||..:...:.:|..|.|.......|||.:..|||||||.
  Fly   131 LGVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEH 195

  Fly   202 GRPIYNPPAPHTHIRVLASKL 222
            |..:.....|||...|:|.:|
  Fly   196 GEIVLRASEPHTSASVVAIRL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 17/48 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108272at50557
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.