DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL5 and AgmNAT

DIOPT Version :9

Sequence 1:NP_611403.1 Gene:AANATL5 / 37210 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster


Alignment Length:217 Identity:57/217 - (26%)
Similarity:100/217 - (46%) Gaps:8/217 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQY-LAVIRQGLSIVALD 70
            |.|.||.:...:..::.||:..:::.:||:..|...|    ..|..|::: |:.:..|...|||.
  Fly     7 DDIVVRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPP----EPEAADKEFLLSNVPFGTCFVALH 67

  Fly    71 DNNGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSSYLSLL 135
            :   |.:|...||...|..|.....:||.:......|.....::.||...::..||.|.|.|.:.
  Fly    68 E---GRIVAAVVAGPKDSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFSVPSCLHVH 129

  Fly   136 VISVHPSMRQRGILVILSKCLFKLGRLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVAYADYKDE 200
            .:.|.|.:|.|.:...|.:.:.:.||..|.:|.....|:.||:|...:.|.:.|:::.|.|:.|.
  Fly   130 ALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRLGYQLINTLRYVDHLDA 194

  Fly   201 QGRPIYNPPAPHTHIRVLASKL 222
            .|:.:..||.||..::.....|
  Fly   195 SGQQVIRPPPPHESVQTFVLHL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 40/153 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100876at33392
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.