DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL5 and AANATL7

DIOPT Version :9

Sequence 1:NP_611403.1 Gene:AANATL5 / 37210 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster


Alignment Length:201 Identity:51/201 - (25%)
Similarity:79/201 - (39%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FHYDEPMGM-------GLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDNNGGLL--VGIAVAET 85
            |..|||:..       |...|....|..|       .|:..:|::|:|......|  ||:.:...
  Fly    22 FFADEPLNKAAGLCQNGSSCPALEAHCAE-------AIQHRMSVMAVDAKEKDTLKIVGVVLNGI 79

  Fly    86 MDPIEMAKQHKEAEEMEPNALGRSRKFIAKVER---EANIFERFGVSSYLSLLVISVHPSMRQRG 147
            :.|.:.|   |...:::.|.....||....:.|   :.|:||.|.|.....:.::||....|.:|
  Fly    80 LKPGDTA---KALSKLDCNDDADFRKIFDLLHRHNLKHNLFEHFDVDCMFDVRILSVDSCYRGQG 141

  Fly   148 ILVILSKCLFKLGRLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVAYADYKDEQGRPIYNPPAPH 212
            |...|.|....:.:..|.||.....|..:|.:.....|.|......|:.|.||.|:.|....|||
  Fly   142 IANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTDENGKVILPVEAPH 206

  Fly   213 THIRVL 218
            ..::.|
  Fly   207 IKLQQL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.