DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL5 and M7.8

DIOPT Version :9

Sequence 1:NP_611403.1 Gene:AANATL5 / 37210 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_502069.1 Gene:M7.8 / 187457 WormBaseID:WBGene00010884 Length:230 Species:Caenorhabditis elegans


Alignment Length:159 Identity:29/159 - (18%)
Similarity:63/159 - (39%) Gaps:26/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLE---EPIHLQHEEEVDRQYLAVIRQGLS 65
            |..|.....|::.::...:..|:.:.|..|||:....:   |.|....:..:||    .::...|
 Worm     7 SATDKYYFEVLRNEEKSEMLKFLLESFRVDEPLNRASKISCEEIEKCLDGALDR----ALKTESS 67

  Fly    66 IVALDDNNGGLLVGIAVAETMDPIE-MAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVS 129
            |:|...:... :||..:.......| :....:|.::.|.:.:.:....:|::..|.:       .
 Worm    68 ILARSQDTHE-IVGCMLNSVWRRDESLCTPGEEDKDFEFHTIRKEVAMVAEILNELH-------E 124

  Fly   130 SYLSLL----------VISVHPSMRQRGI 148
            |:.||.          :.||..:.|::|:
 Worm   125 SFWSLRPDQDVVLHFEISSVSVNHRRQGL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
M7.8NP_502069.1 Acetyltransf_1 82..193 CDD:306954 12/79 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.