DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL5 and T10B5.4

DIOPT Version :9

Sequence 1:NP_611403.1 Gene:AANATL5 / 37210 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001300192.1 Gene:T10B5.4 / 178668 WormBaseID:WBGene00020390 Length:237 Species:Caenorhabditis elegans


Alignment Length:184 Identity:39/184 - (21%)
Similarity:71/184 - (38%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDNNGGLLV---GIAV 82
            :|..|:.::|...||:...|.     ..||:|...::     .|::..|:|....:||   ...|
 Worm    16 QVHKFLVEHFRVMEPITTSLS-----CSEEDVAEFFV-----DLTMSGLEDEKSSILVFDGEEIV 70

  Fly    83 AETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKV------EREANIFERFGVSSYLSLLVISVHP 141
            |..::.::......|:....|:     ..|.|::      ...||....|.......|..::.:|
 Worm    71 AVCLNAVKECSFVSESTPFNPH-----WDFNAEITNGQYKHENANKLVAFVQVLEQDLSFLTGNP 130

  Fly   142 SMRQRGILVILSKCLFKLGRLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVAYA 195
                :.:..|...|:.|..:.:|    ||......|..:|:|..||.:.:||.|
 Worm   131 ----KKVFKIDVLCVSKACQGKG----IGRQLVEKSLENAVKEDCEYVATVATA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
T10B5.4NP_001300192.1 Acetyltransf_1 <110..187 CDD:366181 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.