DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11906 and M1BP

DIOPT Version :9

Sequence 1:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:345 Identity:67/345 - (19%)
Similarity:123/345 - (35%) Gaps:75/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 CRVLNEASYDEEAPSRAIRSSRIYYCRHCDAEFETLISKRQHERMKHQQRYP---CDLCEAQLDT 297
            |||..:.:.::.:|....||:    .:..| ..|.|...    |:::....|   |:.|..:|.:
  Fly    13 CRVCAKYASNKRSPKLFERSN----TKMID-NIEALTGL----RLENYGCLPDQICECCSMELAS 68

  Fly   298 KYEWEMHHTICQAKQEALAIVEQQEAG------------QTVMTSRVPRACSMRSRSRACSEAWD 350
            ..:.. ...|...::..|.:.|:|..|            ..|.|.:.|..          .|.:.
  Fly    69 AVKLR-ERCIAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDD----------DEVYA 122

  Fly   351 RYD---MDEEEEDEEDEEIESGGEELE-----EGEEDAMYARRMNFTGDWIVNHSRSNSNSAGNL 407
            .|.   ::|.:|:.:|.::|......|     .||:||                 .|....|...
  Fly   123 TYQEIVLEEPKEEIDDTKVEYDNTYYEVAEGHAGEDDA-----------------ASLIEEADYD 170

  Fly   408 SLLYGDYGMVETHMTTDKEYDLYLLDLLKTQVRLKSFTCFTPDCGYQTDTLVALMKHDYMEHWKM 472
            |::..|....:| :..|::.:|.:.|:....|             |.:|..||::.:...:.::.
  Fly   171 SIMAEDEEQQQT-LELDEDTELIVGDVNDAYV-------------YDSDDEVAVLDNVLDDEYEH 221

  Fly   473 SWFYCHKCGDVFTSKVFLDYHMHLQNRGLYICHKCREEFELQHQLDRHFQLHRKGINYHCNFCRL 537
            ......||......||..|........|:|||.:|....:.:...:.|.:.||....:.|..|:.
  Fly   222 ENIVVKKCSLPPKPKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQS 286

  Fly   538 EFLSEAKLLAHCKK-LGHSP 556
            .|.:.::|..|.:| .|..|
  Fly   287 RFCTTSELKRHMRKHTGERP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11906NP_611402.2 None
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 15/80 (19%)
C2H2 Zn finger 253..273 CDD:275368 3/19 (16%)
COG5048 276..>331 CDD:227381 8/31 (26%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
zf-H2C2_2 293..317 CDD:290200 5/14 (36%)
C2H2 Zn finger 309..329 CDD:275368
zf-H2C2_2 324..346 CDD:290200
C2H2 Zn finger 337..357 CDD:275368
zf-H2C2_2 350..372 CDD:290200
C2H2 Zn finger 365..383 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.