DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tbrd-2 and KAT2B

DIOPT Version :9

Sequence 1:	NP_611401.2	Gene:	tbrd-2 / 37207	FlyBaseID:	FBgn0034423	Length:	674	Species:	Drosophila melanogaster
Sequence 2:	NP_003875.3	Gene:	KAT2B / 8850	HGNCID:	8638	Length:	832	Species:	Homo sapiens

Alignment Length:	106	Identity:	38/106 - (35%)
Similarity:	61/106 - (57%)	Gaps:	4/106 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 RYTNKLHYFKKHLLDEARKKKYALDFLEPVD-TEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKS 93
            |..::|:...|.:|.:.:..:.|..|:|||. |||   |.||.||..|||:.|:.:|::|.||.|
Human   723 RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEA---PGYYEVIRFPMDLKTMSERLKNRYYVS 784

  Fly    94 VNEAIADFKQIISNCFLFNRSGDVVYRKGQMLEKFFHKKLR 134
            ....:||.:::.:||..:|......|:...:|||||..|::
Human   785 KKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIK 825

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tbrd-2	NP_611401.2	Bromo_gcn5_like	34..136	CDD:99941	37/102 (36%)
KAT2B	NP_003875.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..54
		PCAF_N	75..325	CDD:368925
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	395..436
		COG5076	487..826	CDD:227408	38/106 (36%)
		Acetyl-CoA binding. /evidence=ECO:0000269\|PubMed:10393169	574..576
		Acetyl-CoA binding. /evidence=ECO:0000269\|PubMed:10393169	581..587
		Acetyl-CoA binding. /evidence=ECO:0000269\|PubMed:10393169	612..615
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	706..725		1/1 (100%)
		Bromo_gcn5_like	727..826	CDD:99941	37/102 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900