DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and GCN5

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_011768.1 Gene:GCN5 / 853167 SGDID:S000003484 Length:439 Species:Saccharomyces cerevisiae


Alignment Length:98 Identity:32/98 - (32%)
Similarity:57/98 - (58%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KHLLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQI 104
            :::|.|.:....|..||:||:.|.  ||.||..|..|||:.|:..::::|.|:.:.:.|.|.:.:
Yeast   337 QNILTELQNHAAAWPFLQPVNKEE--VPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLV 399

  Fly   105 ISNCFLFNRSGDVVYRKGQMLEKFFHKKLRGMP 137
            .:||.::|......|:....|||||:.|::.:|
Yeast   400 FNNCRMYNGENTSYYKYANRLEKFFNNKVKEIP 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 31/95 (33%)
GCN5NP_011768.1 COG5076 77..439 CDD:227408 32/98 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.