DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and RSC2

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_013461.1 Gene:RSC2 / 851071 SGDID:S000004349 Length:889 Species:Saccharomyces cerevisiae


Alignment Length:345 Identity:71/345 - (20%)
Similarity:121/345 - (35%) Gaps:113/345 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIISNCFLFNRSGDVVYRKGQMLEKFFHK 131
            |.||.||..|:...|:.||:.  :|....:.:.|..||..|...:|.....:|:...:|||:...
Yeast    53 PDYYAVIKNPVSFNTLKKRIP--HYTDAQQFMNDVVQIPWNAKTYNTRDSGIYKYALVLEKYLKD 115

  Fly   132 KLRGMPSGPEVPCNRDPKAV----GRPRTNAPSSAQTERKCRELLKKL----------QSITNQT 182
            .:  .|:..|    :.|:.|    | |..:.|...:.::|.||..:::          .|..|.|
Yeast   116 TI--YPNLKE----KYPQLVYPDLG-PLPDEPGYEEFQQKLREKAEEVARANAARAESSSSMNST 173

  Fly   183 DAMTRNFFSNKWDSLQK---KVDRQYFKSVNEFCLHVDGCFRKYHEPAKILYERVFNQPAAWCTS 244
            :|..|         |:|   .|.|:                   .||.               |.
Yeast   174 EAARR---------LRKTRTSVKRE-------------------SEPG---------------TD 195

  Fly   245 MNGNSSLESA------LNAADLNELLAAAKLTVNSLMQCVQMPGSGEPLTAKSLVETFCDTLNKM 303
            .|.:...|:.      ...||..:|:....:.:|             |.|.|.|.:      |:.
Yeast   196 TNNDEDYEATDMDIDNPKDADFPDLIRKPLININ-------------PYTRKPLRD------NRS 241

  Fly   304 INKMEAGQRNSPNPSSSKRQKMSPEQETDLVQGEFKPAMELLSGNEIDNLMAVSIESSDDEAIDA 368
            .....:|   :|.|...:.:::|   .|.:.:|. .|.::|.....:.|:|.|    ...|.:|:
Yeast   242 TTPSHSG---TPQPLGPRHRQVS---RTQVKRGR-PPIIDLPYIQRMKNVMKV----LKKEVLDS 295

  Fly   369 SMRITDADRCATQKLFAKLP 388
            .:.:||        ||.:||
Yeast   296 GIGLTD--------LFERLP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 19/68 (28%)
RSC2NP_013461.1 Bromo_Rsc1_2_I 17..121 CDD:99952 20/71 (28%)
COG5076 123..503 CDD:227408 51/271 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.