DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and GTE6

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001190072.1 Gene:GTE6 / 824393 AraportID:AT3G52280 Length:386 Species:Arabidopsis thaliana


Alignment Length:295 Identity:59/295 - (20%)
Similarity:108/295 - (36%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RVQPEFIPHPGMAGRYTNKLHYFKKHLLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIG 80
            ::|.|......:|.:....|......:..:..:.|.|..|:.||:.|.|.:..|:.||.:|||..
plant    92 KIQQEAARREAVAAKRMQDLMRQFGTIFRQITQHKCAWPFMHPVNVEGLGLHDYFEVIDKPMDFS 156

  Fly    81 TIVKRVQ---NNYYKSVNEAIADFKQIISNCFLFN-RSGDVVYRKGQMLEKFFHKKLRGMPSGPE 141
            ||..:::   ...||.|.:..||.:.:..|...:| .:.||.....::||||..|....:|...|
plant   157 TIKNQMEAKDGTGYKHVMQIYADMRLVFENAMNYNEETSDVYSMAKKLLEKFEEKWAHFLPKVQE 221

  Fly   142 VPCNRD------------PKAVGRPRTN-------APSSAQTERKCRELLKKLQSITNQTDAMTR 187
            ....|:            .|.....:|.       ..::.:.|:..|:::::.:.||.:.   .|
plant   222 EEKIREEEEKQAAKEALLAKEASHIKTTRELGNEICHANDELEKLMRKVVERCRKITIEE---KR 283

  Fly   188 N----FFSNKWDSLQK------KVDRQYFKSVNEFCLHVDGCFRKYHEPAKILYERVFNQPAAWC 242
            |    ......|.|||      :.:..:.....|..:.:|                :.::|..|.
plant   284 NIGLALLKLSPDDLQKVLGIVAQANPSFQPRAEEVSIEMD----------------ILDEPTLWR 332

  Fly   243 TSMNGNSSLESAL-----NAADLNELLAAAKLTVN 272
            .......:|::|:     ......||..|.|..|:
plant   333 LKFFVKDALDNAMKKKKEEETKTRELSGAQKKEVS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 30/105 (29%)
GTE6NP_001190072.1 Bromodomain 111..212 CDD:295360 29/100 (29%)
BET 277..338 CDD:293640 12/79 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.