DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and Brd8

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001348065.1 Gene:Brd8 / 78656 MGIID:1925906 Length:954 Species:Mus musculus


Alignment Length:132 Identity:34/132 - (25%)
Similarity:57/132 - (43%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIISNCFL 110
            |...:||..||:||..:  :.|.|::::.||||:.||.|.::|...:|..|...|...:..|..:
Mouse   796 AANHRYANVFLQPVTDD--IAPGYHSIVQRPMDLSTIKKNIENGLIRSTAEFQRDIMLMFQNAVM 858

  Fly   111 FNRSGDVVYRKG--------QMLEKFF--------------HKKLRGMPSGPEVPCN-RDPKAVG 152
            :|.|...||...        :.:::|.              .|.|||..|..:...: :|...:|
Mouse   859 YNSSDHDVYHMAVEMQRDVLEQIQQFLATQLIMQTSESGISAKSLRGRDSTRKQDASEKDSVPMG 923

  Fly   153 RP 154
            .|
Mouse   924 SP 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 29/111 (26%)
Brd8NP_001348065.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..273
Atrophin-1 <176..356 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 520..547
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 584..745
Bromo_brd8_like 782..885 CDD:99939 25/90 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 900..922 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.