DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and brd2b

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001103994.1 Gene:brd2b / 569354 ZFINID:ZDB-GENE-070220-1 Length:276 Species:Danio rerio


Alignment Length:181 Identity:61/181 - (33%)
Similarity:96/181 - (53%) Gaps:17/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PNRVQPEFIPHPGMAGRYTNKLHYFKKHLLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMD 78
            |..:||. :..|...||.||:|.:..|.|:....:..:|..|.||||...|.:|.|:.:|.:|||
Zfish    55 PPPLQPP-VRDPSRQGRATNQLQFLHKVLVKALWRHHFAWPFHEPVDATRLNLPDYHKIIKQPMD 118

  Fly    79 IGTIVKRVQNNYYKSVNEAIADFKQIISNCFLFNRSGDVVYRKGQMLEKFFHKKLRGMPSGP-EV 142
            :|||.||::||||:..:|.:.||..:.:||:::|:..|.:....|.|||.|.:|:..||... |:
Zfish   119 MGTIKKRLENNYYRGASECLQDFNTMFTNCYIYNKPADDIVLMAQSLEKVFLQKVAQMPQDEIEL 183

  Fly   143 PCNRDPKAVGRPRTNAPSSAQTERKCRELLKKLQSIT--NQTDAMTRNFFS 191
            | :..|:..|.....|       ||.|.     .|:|  :|..|::.:.:|
Zfish   184 P-SPTPRGRGNKSVKA-------RKSRG-----GSVTSAHQVPAVSHSAYS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 38/101 (38%)
brd2bNP_001103994.1 Bromo_Brdt_I_like 70..176 CDD:99929 41/105 (39%)
Pol_alpha_B_N <161..>248 CDD:285602 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4352
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.