DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and kat2b

DIOPT Version :10

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001038499.1 Gene:kat2b / 563942 ZFINID:ZDB-GENE-060503-207 Length:796 Species:Danio rerio


Alignment Length:133 Identity:42/133 - (31%)
Similarity:68/133 - (51%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPL--SVKLKLPNRVQPEFIPHPGMAGRYTNKLHYFKKHLLDEARKKKYALDFLEPV-DTEALMV 66
            |||  |.:||.|                  ::|:...|::|.:.:....|..|:||| ..||   
Zfish   678 KPLGKSKELKDP------------------DQLYSTLKNILTQVKSHPNAWPFMEPVKKNEA--- 721

  Fly    67 PTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIISNCFLFNRSGDVVYRKGQMLEKFFHK 131
            |.||.||..|||:.|:.:|:::.||.:....:||.::|.:||..:|......|:...:|||||:.
Zfish   722 PGYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFFYT 786

  Fly   132 KLR 134
            |::
Zfish   787 KIK 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 35/102 (34%)
kat2bNP_001038499.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
PCAF_N 40..293 CDD:461923
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..97
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..408
COG5076 453..784 CDD:227408 39/126 (31%)
Bromo_gcn5_like 691..790 CDD:99941 35/102 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.