DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and Baz2b

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:XP_011237963.1 Gene:Baz2b / 407823 MGIID:2442782 Length:2197 Species:Mus musculus


Alignment Length:91 Identity:29/91 - (31%)
Similarity:45/91 - (49%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIIS 106
            :|.|....:.:..||.||:.:  :||.|..||.:|||..||.:::.|..|.:......|.:.:..
Mouse  2101 ILTEMETHEDSWPFLLPVNLK--LVPGYKKVIKKPMDFSTIREKLNNGQYPNFETFALDVRLVFD 2163

  Fly   107 NCFLFNRSGDVVYRKGQMLEKFFHKK 132
            ||..||.....:.|.|..:.|:|.||
Mouse  2164 NCETFNEDDSDIGRAGHSMRKYFEKK 2189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 29/91 (32%)
Baz2bXP_011237963.1 MBD 758..827 CDD:412167
TPH <835..1052 CDD:404709
DDT 1079..1142 CDD:214726
WHIM1 1183..1223 CDD:406127
WSD 1363..>1395 CDD:406128
WSD <1706..1745 CDD:406128
PHD_BAZ2B 1961..2009 CDD:277100
Bromo_BAZ2A_B_like 2094..2190 CDD:99935 29/91 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.