DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and Baz1b

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001178845.1 Gene:Baz1b / 368002 RGDID:1597089 Length:1476 Species:Rattus norvegicus


Alignment Length:102 Identity:32/102 - (31%)
Similarity:47/102 - (46%) Gaps:6/102 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KHLLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQI 104
            :.:|.:..|.:::..|.|||..:.  ...||.||..|||..|:..:.....|:||.|.:.|.||:
  Rat  1342 EEILHKLVKYRFSWPFREPVTRDE--AEDYYDVIDHPMDFQTMQNKCSCGNYRSVQEFLTDVKQV 1404

  Fly   105 ISNCFLFNRSGDVVY----RKGQMLEKFFHKKLRGMP 137
            .:|..|:|..|..|.    :..|.|.....|.|.|.|
  Rat  1405 FANAELYNCRGSHVLSCMEKTEQCLLALLQKHLPGHP 1441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 30/99 (30%)
Baz1bNP_001178845.1 WAC_Acf1_DNA_bd 21..120 CDD:287503
DDT 602..666 CDD:214726
WHIM1 722..771 CDD:292246
WHIM2 897..925 CDD:292247
WHIM3 988..1026 CDD:292248
PHD_BAZ1B 1183..1228 CDD:277098
Bromo_WSTF_like 1337..1433 CDD:99937 28/92 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.