DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and BAZ2B

DIOPT Version :10

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:XP_047299993.1 Gene:BAZ2B / 29994 HGNCID:963 Length:2248 Species:Homo sapiens


Alignment Length:49 Identity:13/49 - (26%)
Similarity:19/49 - (38%) Gaps:11/49 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PKMTELLEPSEEIDLAI------VDVDDNAELVQTFEVKAV-----PAI 102
            |:...||.|..|:.:.|      .|..:|.|..|..:..|.     ||:
Human   127 PEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 13/49 (27%)
BAZ2BXP_047299993.1 HAT_MBD 761..833 CDD:238691
DUF5401 <847..>1072 CDD:375164
DDT 1106..1168 CDD:214726
WSD 1389..>1421 CDD:464775
WSD <1729..1768 CDD:464775
PHD_BAZ2B 1984..2032 CDD:277100
Bromo_BAZ2A_B_like 2117..2213 CDD:99935
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.