DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and BAZ2B

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:XP_024308593.1 Gene:BAZ2B / 29994 HGNCID:963 Length:2259 Species:Homo sapiens


Alignment Length:546 Identity:112/546 - (20%)
Similarity:182/546 - (33%) Gaps:169/546 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 SMNG-NSSLESALNAADLNELLAAAKLTVNSL------MQCVQMPGSGEPLTAKSLVETFCD--T 299
            |:|| |:|....:|.:.|:...:::.....|.      .:|.|.....:||.|:  |:...|  .
Human   189 SINGSNTSSVIGINTSVLSTTASSSMGQTKSTSSGGGNRKCNQEQSKNQPLDAR--VDKIKDKKP 251

  Fly   300 LNKMINKMEAGQRNSPNPSSSKRQKMSPEQETDLVQGEFKPAMELLSGNEIDNLMAVSIESSDDE 364
            ..|.:........:|...|.:..:.:|.....||.:.|          .|.|.    |||.|:|:
Human   252 RKKAMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDE----------EEEDQ----SIEESEDD 302

  Fly   365 AIDASMR-------------ITD--AD-RCATQK------------------------------L 383
            ..|:...             |:|  || :.||:|                              |
Human   303 DSDSESEAQHKSNNQVLLHGISDPKADGQKATEKAQEKRIHQPLPLASESQTHSFQSQQKQPQVL 367

  Fly   384 FAKLP-----TNAMKEIIH---MVQQIEGFSSENCGDLSFDVKGLATDT---MIMMKSAVTKA-- 435
            ..:||     :.|.:|.::   .|.|..|..| |...||. |.....:|   :|:....|.||  
Human   368 SQQLPFIFQSSQAKEESVNKHTSVIQSTGLVS-NVKPLSL-VNQAKKETYMKLIVPSPDVLKAGN 430

  Fly   436 --TRAHSKLKLKDMQPSEKEGLQRALQSQLVN----------ITRMLNKNRRRCGP--------- 479
              |...|.|...::: |::|..::|..|||..          |..:.|.......|         
Human   431 KNTSEESSLLTSELR-SKREQYKQAFPSQLKKQESSKSLKKVIAALSNPKATSSSPAHPKQTLEN 494

  Fly   480 ------LINFRNKNNTANNVVR---KRATAPLTAKLKPLQANVMAPQLGAGVVETHNLSDTSDDD 535
                  |.|....|:..|.|::   :.|...||.|.| :|:.:           ..|::..|...
Human   495 NHPNPFLTNALLGNHQPNGVIQSVIQEAPLALTTKTK-MQSKI-----------NENIAAASSTP 547

  Fly   536 VSAPVKLSAIG-GTPMRNLPI-------------------NSNPLQMQPIRSPPKLPHVVELQMS 580
            .|:||.||..| .||....|:                   |.||::.|....|.|  .:||    
Human   548 FSSPVNLSTSGRRTPGNQTPVMPSASPILHSQGKEKAVSNNVNPVKTQHHSHPAK--SLVE---- 606

  Fly   581 SSSSSESEMKSKSGRLSRSRSRSMSDTKLRPRSNSSASSRSNSSSSSGSNAGSSSGSRSRSSSSS 645
            ....::|::.|         |:...|:......:.......:.......::.|.|.|.|.|.:..
Human   607 QFRGTDSDIPS---------SKDSEDSNEDEEEDDEEEDEEDDEDDESDDSQSESDSNSESDTEG 662

  Fly   646 SSSSNNSSESNDSSDVEVVPNVPEGQ 671
            |...::..:..|.||.:.     ||:
Human   663 SEEEDDDDKDQDESDSDT-----EGE 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941
BAZ2BXP_024308593.1 Nucleoporin_FG2 42..>226 CDD:330420 8/36 (22%)
HAT_MBD 761..833 CDD:238691
TPH 903..>1089 CDD:316391
DDT 1117..1179 CDD:214726
WSD 1400..>1432 CDD:317927
WSD <1740..1779 CDD:317927
PHD_BAZ2B 1995..2043 CDD:277100
Bromo_BAZ2A_B_like 2128..2224 CDD:99935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.