DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and KAT2A

DIOPT Version :10

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001363156.1 Gene:KAT2A / 2648 HGNCID:4201 Length:838 Species:Homo sapiens


Alignment Length:103 Identity:36/103 - (34%)
Similarity:60/103 - (58%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NKLHYFKKHLLDEARKKKYALDFLEPV-DTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNE 96
            ::|:...|:||.:.:....|..|:||| .:||   |.||.||..|:|:.|:.:|:::.||.:...
Human   732 DQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEA---PDYYEVIRFPIDLKTMTERLRSRYYVTRKL 793

  Fly    97 AIADFKQIISNCFLFNRSGDVVYRKGQMLEKFFHKKLR 134
            .:||.:::|:||..:|.......|....|||||:.||:
Human   794 FVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLK 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 36/102 (35%)
KAT2ANP_001363156.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
PCAF_N 86..335 CDD:461923
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..434
COG5076 492..833 CDD:227408 36/103 (35%)
Loop 3. /evidence=ECO:0000269|PubMed:29211711 639..648
Bromo_gcn5_like 733..832 CDD:99941 36/102 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.