DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tbrd-2 and Baz1b

DIOPT Version :9

Sequence 1:	NP_611401.2	Gene:	tbrd-2 / 37207	FlyBaseID:	FBgn0034423	Length:	674	Species:	Drosophila melanogaster
Sequence 2:	NP_035844.2	Gene:	Baz1b / 22385	MGIID:	1353499	Length:	1479	Species:	Mus musculus

Alignment Length:	100	Identity:	33/100 - (33%)
Similarity:	46/100 - (46%)	Gaps:	6/100 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 LLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIIS 106
            :|.:..|.:::..|.|||..:.  ...||.||..|||..||..:.....|:||.|.:.|.||:.:
Mouse  1347 ILHKLVKYRFSWPFREPVTRDE--AEDYYDVIEHPMDFQTIQNKCSCGNYRSVQEFLTDMKQVFA 1409

  Fly   107 NCFLFNRSGDVVY----RKGQMLEKFFHKKLRGMP 137
            |..|:|..|..|.    :..|.|.....|.|.|.|
Mouse  1410 NAELYNCRGSHVLSCMEKTEQCLLALLQKHLPGHP 1444

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tbrd-2	NP_611401.2	Bromo_gcn5_like	34..136	CDD:99941	31/97 (32%)
Baz1b	NP_035844.2	WAC_Acf1_DNA_bd	21..120	CDD:287503
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	146..212
		C motif	207..213
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	302..333
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	376..433
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	448..472
		DDT	605..669	CDD:214726
		WHIM1	725..770	CDD:292246
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	789..813
		WHIM2	900..928	CDD:292247
		WHIM3	991..1029	CDD:292248
		PHD_BAZ1B	1186..1231	CDD:277098
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1231..1324
		Bromo_WSTF_like	1340..1436	CDD:99937	29/90 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1451..1479
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900