DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and BPTF

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:XP_005257207.1 Gene:BPTF / 2186 HGNCID:3581 Length:3158 Species:Homo sapiens


Alignment Length:104 Identity:42/104 - (40%)
Similarity:58/104 - (55%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TNKLHYFKKHLLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNE 96
            |.|.:...|.:|...:..|.|..||||||...  .|.||.||..|||:.|:.:|||..||:.:.|
Human  3041 TEKDYEGLKRVLRSLQAHKMAWPFLEPVDPND--APDYYGVIKEPMDLATMEERVQRRYYEKLTE 3103

  Fly    97 AIADFKQIISNCFLFNRSGDVVYRKGQMLEKFFHKKLRG 135
            .:||..:|..||..:|.|....|:..::||.||.:||:|
Human  3104 FVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKG 3142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 41/102 (40%)
BPTFXP_005257207.1 DDT 241..297 CDD:280886
WHIM1 339..388 CDD:292246
PHD1_BPTF 392..434 CDD:277034
Med15 2217..>2598 CDD:255446
TNG2 2742..2972 CDD:227367
PHD2_3_BPTF 2923..2969 CDD:277035
PHD2_3_BPTF 2981..3027 CDD:277035
Bromo_gcn5_like 3043..3143 CDD:99941 41/102 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.