DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and C49F5.5

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001359599.1 Gene:C49F5.5 / 183614 WormBaseID:WBGene00008209 Length:115 Species:Caenorhabditis elegans


Alignment Length:109 Identity:24/109 - (22%)
Similarity:40/109 - (36%) Gaps:32/109 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 KVDRQYFKSVNE---FCLHVDGCFRKYHEPAKILYERVFN-QPAAWCTSMNGNSSLESALNAADL 260
            ::|....|.:.|   ..||.:.|.::..|.    |:...| |||     .:....|.|.      
 Worm     9 RIDPHILKVIKEQLILLLHANVCTKRDREN----YQAAINGQPA-----RHPRCDLPSC------ 58

  Fly   261 NELLAAAKLTVNSLMQCVQMPGSGEPLTAKSLVETFCDTLNKMI 304
                ...|.|::.|..|..  ||      ..|:: :|:|..::|
 Worm    59 ----GLFKYTLSHLNMCTN--GS------HCLID-YCNTSKQLI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941
C49F5.5NP_001359599.1 ZnF_TAZ 12..106 CDD:214717 23/106 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.