DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and C29F9.5

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001355379.1 Gene:C29F9.5 / 183022 WormBaseID:WBGene00016220 Length:261 Species:Caenorhabditis elegans


Alignment Length:248 Identity:46/248 - (18%)
Similarity:78/248 - (31%) Gaps:76/248 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LHVDGCFRKYHEPAKILYERVFNQPA--AWCTSMNGNSSLESALNAADLNELLAAAKLTVNSLMQ 276
            ||...|.|:   ..||......|:||  |.|...:                 ....|..:..:..
 Worm    48 LHAHECVRR---DIKIREAAEKNEPAPHAMCKIQD-----------------CVIMKEVLKHMTS 92

  Fly   277 CVQMPGSGEPLTAKSLVETFCDTLNKMIN------KMEAGQRNSPNPSSSKRQKMSPEQE----- 330
            |.:.|.......|.|  .|......|..|      |....||.:|...::..:...||.:     
 Worm    93 CKEGPKCNSVHCASS--RTILSHWKKCFNEECPVCKPIIEQRTAPPQDTTPAEPKKPEHDQIWHL 155

  Fly   331 -------TDLVQGEFKPAMELLSGNEIDNLMAVSIESSDDEAIDASMRITDADRCATQKLFAKLP 388
                   ::|::..:|   .::|..:...|....:::..:.:..|.::|.|    ..|||.|   
 Worm   156 EVPKTYRSELIEKIYK---GIMSNVKPGTLSEAQMDTWKEYSRSAELQIFD----TAQKLEA--- 210

  Fly   389 TNAMKEIIHMVQQ-----IEGF-------------SSENCGDLSFDVKGLATD 423
                  ..||.::     .|||             .||...:....::|.:||
 Worm   211 ------YYHMAREKVCRYQEGFPRRQKTEEKDESDGSEKEDEADDRLEGTSTD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941
C29F9.5NP_001355379.1 ZnF_TAZ 40..128 CDD:214717 20/101 (20%)
KIX 153..223 CDD:280354 13/85 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.