DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and F13C5.2

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_508124.1 Gene:F13C5.2 / 180410 WormBaseID:WBGene00017423 Length:374 Species:Caenorhabditis elegans


Alignment Length:116 Identity:37/116 - (31%)
Similarity:52/116 - (44%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HLLDEARK-------------KKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYK 92
            ||.||.:|             ..:...|.:|||...|.:..|:.||.:|||:.||.|::....|.
 Worm   114 HLHDELKKCLSILKEFEKSTHDSFTFPFRKPVDVVLLGLTDYHEVIKKPMDMSTIRKKLIGEEYD 178

  Fly    93 SVNEAIADFKQIISNCFLFNRSGDVV------YRKGQMLEKFFHKKLRGMP 137
            :..|...|||.:|:||..:|..||.|      :||     ||..|..:..|
 Worm   179 TAVEFKEDFKLMINNCLTYNNEGDPVADFALQFRK-----KFAAKWKKEFP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 36/113 (32%)
F13C5.2NP_508124.1 Bromodomain 118..219 CDD:383021 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.