DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and baz-2

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_498673.3 Gene:baz-2 / 176078 WormBaseID:WBGene00001470 Length:1390 Species:Caenorhabditis elegans


Alignment Length:108 Identity:35/108 - (32%)
Similarity:56/108 - (51%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PGMAGRYTNKLHYFKKHLLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNN 89
            |.:.|...|......:.:|||...:..||.|||||:.:  :||.|..:|.:|||:.||.::.:..
 Worm  1268 PSIGGLPKNMNKELCQLMLDELVVQANALPFLEPVNPK--LVPGYKMIISKPMDLKTIRQKNEKL 1330

  Fly    90 YYKSVNEAIADFKQIISNCFLFNRSGDVVYRKGQMLEKFFHKK 132
            .|::..:...|.:.:.:||..||.....:.|.|..|.|||.|:
 Worm  1331 IYETPEDFAEDIELMFANCRQFNIDHSEIGRAGISLHKFFQKR 1373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 32/99 (32%)
baz-2NP_498673.3 FlgD 35..88 CDD:281896
HAT_MBD 328..401 CDD:238691
DDT 524..>564 CDD:295426
WHIM1 622..670 CDD:292246
WHIM3 899..931 CDD:292248
PHD_BAZ2A_like 1102..1146 CDD:277020
PHD 1155..1199 CDD:214584
Bromo_BAZ2A_B_like 1278..1374 CDD:99935 32/98 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.