DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and athp-2

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_494767.2 Gene:athp-2 / 173769 WormBaseID:WBGene00019217 Length:1412 Species:Caenorhabditis elegans


Alignment Length:92 Identity:32/92 - (34%)
Similarity:54/92 - (58%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LLDEARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIIS 106
            ||.||.:::.:..||:|||::.  ||.||.||.|||::.|::.:::...|....|...||:.|:|
 Worm  1317 LLKEAMRQECSWPFLQPVDSKE--VPDYYDVIKRPMNLRTMMNKIKQRIYNKPIEVRNDFQLILS 1379

  Fly   107 NCFLFNRSGDVVYRKGQMLEKFFHKKL 133
            ||..:|...:.:|:..:.|..|...:|
 Worm  1380 NCETYNEPENEIYKLSRELHDFMADRL 1406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 32/92 (35%)
athp-2NP_494767.2 WAC_Acf1_DNA_bd 23..123 CDD:402251
DDT 457..524 CDD:214726
WHIM1 629..671 CDD:406127
WSD 795..897 CDD:406128
PHD 1100..1144 CDD:214584
BROMO 1306..1409 CDD:197636 32/92 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.