DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and pcaf-1

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_491173.1 Gene:pcaf-1 / 171920 WormBaseID:WBGene00021636 Length:767 Species:Caenorhabditis elegans


Alignment Length:144 Identity:41/144 - (28%)
Similarity:64/144 - (44%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PEFIPHPGMAGRYTNKLHYFKKHLLDE----------ARKKKYALD-----FLEPVDTEALMVPT 68
            |:.:....:.|..:.|:|....:.|||          |..||...|     |..|||.:.  ||.
 Worm   620 PQLLELRKVPGTDSLKMHKKSCYHLDERDDSLDSKIGAILKKLTADKNAWPFASPVDVKE--VPE 682

  Fly    69 YYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIISNCFLFNRSGDVVYRKGQMLEKFFHKKL 133
            ||..|..|:|..|:.::::...|...:..|||..::..||::||.:..|.|:.|..|.:...|.|
 Worm   683 YYDHIKHPIDFKTMQEKLKRKAYTHQHLFIADLNRLFQNCYVFNGAEAVYYKYGYKLNELALKLL 747

  Fly   134 R-GMPSG---PEVP 143
            : ..|..   ||:|
 Worm   748 KTSFPESSWYPELP 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 35/117 (30%)
pcaf-1NP_491173.1 PCAF_N 9..247 CDD:283997
COG5076 408..735 CDD:227408 33/116 (28%)
Acetyltransf_1 476..544 CDD:278980
Bromo_gcn5_like 650..748 CDD:99941 29/99 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.