DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-2 and BRD8

DIOPT Version :9

Sequence 1:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_631938.2 Gene:BRD8 / 10902 HGNCID:19874 Length:1235 Species:Homo sapiens


Alignment Length:531 Identity:99/531 - (18%)
Similarity:165/531 - (31%) Gaps:190/531 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ARKKKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIISNCFL 110
            |...:||..||:||..:  :.|.|::::.||||:.||.|.::|...:|..|...|...:..|..:
Human   723 AANHRYANVFLQPVTDD--IAPGYHSIVQRPMDLSTIKKNIENGLIRSTAEFQRDIMLMFQNAVM 785

  Fly   111 FNRSGDVVYRKG--------QMLEKFF--------------HKKLRGMPSGPEVPCN-RDPKAVG 152
            :|.|...||...        :.:::|.              .|.|||..|..:...: :|...:|
Human   786 YNSSDHDVYHMAVEMQRDVLEQIQQFLATQLIMQTSESGISAKSLRGRDSTRKQDASEKDSVPMG 850

  Fly   153 RP-----------------RTNAPSSAQTERKCRELLKKLQSITNQTDAMTRNFFSNKWDSLQKK 200
            .|                 ..:.|:.::....||.|                  ||: |||    
Human   851 SPAFLLSLFMGHEWVWLDSEQDHPNDSELSNDCRSL------------------FSS-WDS---- 892

  Fly   201 VDRQYFKSVNEFCLHVD-GCFRKYHEP-AKILYE-RVFNQPAAWCTSMNGNSSLESALNAADLNE 262
                        .|.:| |.:|:..:| |:.|.| ....:|:.......|:...:.|...|....
Human   893 ------------SLDLDVGNWRETEDPEAEELEESSPEREPSELLVGDGGSEESQEAARKASHQN 945

  Fly   263 LLAAAKLTVNSLMQ--CV------------------------------------QMPGSGEPLTA 289
            ||.... .|..||:  |:                                    ::...|:||.|
Human   946 LLHFLS-EVAYLMEPLCISSNESSEGCCPPSGTRQEGREIKASEGERELCRETEELSAKGDPLVA 1009

  Fly   290 K------------SLVETFCDTLNKMINKMEAGQRNSPNPSSSKRQKMSPEQETDLVQGEFKPAM 342
            :            |.....| |:..::.:.|.|:....:....:.:....|.|.....||...|.
Human  1010 EKPLGENGKPEVASAPSVIC-TVQGLLTESEEGEAQQESKGEDQGEVYVSEMEDQPPSGECDDAF 1073

  Fly   343 ELLSGNEIDNLMAVSIESSDDEAIDASMRITDA---DRCATQKLFAKLPTNAMKEIIHMVQQIEG 404
            .:.....:|.|.:.:          .|.::||.   |......||.|......|.|         
Human  1074 NIKETPLVDTLFSHA----------TSSKLTDLSQDDPVQDHLLFKKTLLPVWKMI--------- 1119

  Fly   405 FSSENCGDLSFDVKGLATDTMIMMKSAVTKATRAHSKLKLKDMQ----PSEKEGLQRALQSQLVN 465
                                          |:...|...||.:.    |..|:.::|.:  .|.:
Human  1120 ------------------------------ASHRFSSPFLKPVSERQAPGYKDVVKRPM--DLTS 1152

  Fly   466 ITRMLNKNRRR 476
            :.|.|:|.|.|
Human  1153 LKRNLSKGRIR 1163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 29/111 (26%)
BRD8NP_631938.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..205
termin_org_DnaJ <302..>681 CDD:274808
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 621..672
Bromo_brd8_like 709..812 CDD:99939 25/90 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 827..848 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 903..940 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 966..999 0/32 (0%)
Bromo_brd8_like 1105..1208 CDD:99939 18/100 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.