DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wbl and SPAC17H9.14c

DIOPT Version :9

Sequence 1:NP_001286609.1 Gene:wbl / 37206 FlyBaseID:FBgn0004003 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_593584.1 Gene:SPAC17H9.14c / 2542270 PomBaseID:SPAC17H9.14c Length:359 Species:Schizosaccharomyces pombe


Alignment Length:242 Identity:56/242 - (23%)
Similarity:97/242 - (40%) Gaps:57/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VDLDELSFEKTVERFPYSV-VKF---------DIAYPYGEKHEAFTAFSKSAHKATKDLLIATVG 82
            |:||.|:|:|.|......| |:|         .:|..|....:.|        |...::.|..:.
pombe   143 VELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTYETLGKVF--------KNEPNVEIVKIN 199

  Fly    83 V---KDYGELENKALGDRYKV---DDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTP 141
            .   .|.|.|...|.....|.   |||:.|.  |::|            |.:|::|..:::..:.
pombe   200 ADVFADIGRLHEVASFPTIKFFPKDDKDKPE--LYEG------------DRSLESLIEYINKKSG 250

  Fly   142 LYIGRDGC-------IKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMR 199
            .....||.       |..|:|....:.::.:|.:..::||:  ||..|.|..:      :..|.:
pombe   251 TQRSPDGTLLSTAGRIPTFDEFAAEFLDMSNAAKEVVLEKV--KQLALEDSSR------WTKYYK 307

  Fly   200 KIHEV---GYDFLEEETKRLLRLKAGK-VTEAKKEELLRKLNILEVF 242
            |:.|.   ..:::.:|.|||.:|...| :..|..::...:||||..|
pombe   308 KVFEKILNDENWVHKEAKRLSKLLRQKSIALASADDFKTRLNILNSF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wblNP_001286609.1 ERp29_N 22..147 CDD:254509 29/134 (22%)
ERp29 149..242 CDD:285048 24/103 (23%)
SPAC17H9.14cNP_593584.1 PDI_a_ERp38 21..125 CDD:239296
Thioredoxin_6 55..247 CDD:290560 29/125 (23%)
PDI_a_ERp38 141..245 CDD:239296 29/123 (24%)
ERp29 265..354 CDD:285048 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.