DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wbl and Erp29

DIOPT Version :9

Sequence 1:NP_001286609.1 Gene:wbl / 37206 FlyBaseID:FBgn0004003 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_446413.1 Gene:Erp29 / 117030 RGDID:619781 Length:260 Species:Rattus norvegicus


Alignment Length:266 Identity:82/266 - (30%)
Similarity:140/266 - (52%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMHILVTLLLVA-------IHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEK 58
            ::.:|:.|||::       :|:         .|.:.||.::|.|.:.:..:.:||||..||||||
  Rat    14 LLSVLLGLLLLSAPHGASGLHT---------KGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEK 69

  Fly    59 HEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPS 123
            .:.|...:::: .::.|||:|.||:.|||:..|..|.::||:|.:::|..:||: :.|....:|.
  Rat    70 QDEFKRLAENS-ASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFR-DGDFENPVPY 132

  Fly   124 HVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQ 188
            ...|.:..::.::... .:|:|..||:..::.:...:......|..:.|  |:..|:.|:..::.
  Rat   133 SGAVKVGAIQRWLKGQ-GVYLGMPGCLPAYDALAGQFIEASSREARQAI--LKQGQDGLSGVKET 194

  Fly   189 QN--ARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTA 251
            ..  |..||..|.||.:.|.||...|..|:.:|...|::|.|||||.|.||||..||     |..
  Rat   195 DKKWASQYLKIMGKILDQGEDFPASELARISKLIENKMSEGKKEELQRSLNILTAFR-----KKG 254

  Fly   252 PEKEEL 257
            .|||||
  Rat   255 AEKEEL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wblNP_001286609.1 ERp29_N 22..147 CDD:254509 38/124 (31%)
ERp29 149..242 CDD:285048 30/94 (32%)
Erp29NP_446413.1 PDI_a_ERp29_N 36..149 CDD:239305 36/115 (31%)
ERp29 157..250 CDD:400209 30/94 (32%)
Prevents secretion from ER 257..260 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335249
Domainoid 1 1.000 76 1.000 Domainoid score I8765
eggNOG 1 0.900 - - E1_28K2V
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4963
Inparanoid 1 1.050 121 1.000 Inparanoid score I4667
OMA 1 1.010 - - QHG59606
OrthoDB 1 1.010 - - D1535651at2759
OrthoFinder 1 1.000 - - FOG0012441
OrthoInspector 1 1.000 - - oto97745
orthoMCL 1 0.900 - - OOG6_109017
Panther 1 1.100 - - LDO PTHR12211
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.