DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wbl and erp29

DIOPT Version :9

Sequence 1:NP_001286609.1 Gene:wbl / 37206 FlyBaseID:FBgn0004003 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002940171.3 Gene:erp29 / 100487468 XenbaseID:XB-GENE-6045950 Length:257 Species:Xenopus tropicalis


Alignment Length:257 Identity:76/257 - (29%)
Similarity:136/257 - (52%) Gaps:19/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKS 68
            :|||.|      :...||:...|.:.||.::|.|.:.:..:.:||||..||||.:.:.|...::|
 Frog    17 LLVTCL------VQRCWAMHTKGSLALDHITFYKVIPKSRFVLVKFDTQYPYGVQQDEFKQLAES 75

  Fly    69 AHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLF-KGNADEYVQLPSHVDVTLDNL 132
            : .::||||:|.||:.|||:..|..|.:::.:|.:.||..:|| .||....|.....|..:...|
 Frog    76 S-SSSKDLLVAHVGISDYGDKLNLELAEKFNLDKEKFPYYYLFVNGNIANPVIYVGPVKTSAIQL 139

  Fly   133 KAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAE-QLKLIEKLQAKQEQLTDPEQQQNARAYLI 196
            ......   :|:|..|||::::.:...:....:.| |..|:.:.:|...:..:.|:.. |..|:.
 Frog   140 WLKTQG---VYLGMPGCIEQYDALAGEFLLTTEKEKQSNLLIRARALMAEAGESEKHA-AEQYIK 200

  Fly   197 YMRKIHEVGYDFLEEETKRLLRL-KAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL 257
            .|.||.:.|.:|...|.:|:.:| :..::::.||::|.::||||..|: :|.|.    :|||
 Frog   201 IMSKIIDQGENFAHNEYERITKLIEKNQMSQPKKDDLQKRLNILSSFQ-NKNTM----REEL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wblNP_001286609.1 ERp29_N 22..147 CDD:254509 39/125 (31%)
ERp29 149..242 CDD:285048 24/94 (26%)
erp29XP_002940171.3 Thioredoxin_like 29..151 CDD:412351 39/125 (31%)
ERp29 153..247 CDD:400209 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4963
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535651at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4822
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.